PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g008153m
Common NameCISIN_1g008153mg, LOC102629959
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 577aa    MW: 63477.3 Da    PI: 4.8416
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g008153mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.71.5e-1392065681374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        lv++L++cAea+++++l+ a+al++++  la+ ++ +m+++a+yf+eALa+r++r    +y    p++  +++  + l+    f+e++P+lk
  orange1.1g008153m 206 LVHTLMACAEAIQQENLKVADALVKHIGLLAAAQAGAMRKVATYFAEALARRIYR----IY----PQDCLDSSYNDILQ--MHFYETCPYLK 287
                        689****************************************************....44....34433223444433..36********* PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        f+h+taNqaIlea+++++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++A+++gv+fef+ +v++
  orange1.1g008153m 288 FAHFTANQAILEAFNNANRVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLADTIGVEFEFRGFVCN 379
                        ******************************************************************************************** PP

               GRAS 185 rledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        +l+dle+++L+++p   E++aVn+v++lhrll++++ +e+    v++ +k ++Pk++++veqea+hns+ Fl+rf+eal+yys+lfdsle +
  orange1.1g008153m 380 SLADLEPDMLDIRPpeVETVAVNSVFELHRLLARPGGIEK----VVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEGS 467
                        **************9999*********************9....*********************************************777 PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdr 365
                          +  ++++++++++lgr+i+n+vac g++r+erhetl +Wr rl++aGF+pv+l+++a+kqa++ll+ ++ +dgyrvee++g+l+lgW++r
  orange1.1g008153m 468 GLTPPSQDQVMSEVYLGRQICNIVACDGTDRNERHETLTQWRTRLGSAGFEPVHLGSNAYKQASMLLALFAgGDGYRVEENNGCLMLGWHTR 559
                        556668889999999***************************************************************************** PP

               GRAS 366 pLvsvSaWr 374
                        pL+++SaW+
  orange1.1g008153m 560 PLIATSAWQ 568
                        ********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.9E-3543109IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.6E-3943116No hitNo description
PROSITE profilePS5098568.426180547IPR005202Transcription factor GRAS
PfamPF035145.0E-137206568IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MKRDHQHSYG GGSGSGKGDY SSSTGNANKA KMWEEEQDTG GMDELLEVLG YKVRSSEMAD  60
VAQKLEQLEM VMGTAQEDGI SHLATDTVHY NPSDVSGWVQ SMLEGLNNTG FDSQARPIQD  120
PAESSTVNSI LGQQTSNQSR IFNDDSEYDL RAIPGSAAYP QPDSETENNR NKRMRVEINT  180
ANTNTIIPTE LARPVVVDSQ ETGVQLVHTL MACAEAIQQE NLKVADALVK HIGLLAAAQA  240
GAMRKVATYF AEALARRIYR IYPQDCLDSS YNDILQMHFY ETCPYLKFAH FTANQAILEA  300
FNNANRVHVI DFSLKQGMQW PALMQALALR PGGPPAFRLT GIGPPQPDNT DALQQVGWKL  360
AQLADTIGVE FEFRGFVCNS LADLEPDMLD IRPPEVETVA VNSVFELHRL LARPGGIEKV  420
VSSIKAMRPK IITIVEQEAN HNSPVFLDRF TEALHYYSSL FDSLEGSGLT PPSQDQVMSE  480
VYLGRQICNI VACDGTDRNE RHETLTQWRT RLGSAGFEPV HLGSNAYKQA SMLLALFAGG  540
DGYRVEENNG CLMLGWHTRP LIATSAWQLA KSTLVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-532065684375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.4530.0callus| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482132.10.0PREDICTED: DELLA protein GAI
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLA0A067EIU70.0A0A067EIU7_CITSI; Uncharacterized protein
STRINGPOPTR_0005s14540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein